Scaffold Ga0208905_1004525

Overview

Basic Information

• Taxon OID: 3300025661
• Scaffold ID: Ga0208905_1004525
• Source Dataset Name: Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6310
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042665	Metagenome	157	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208905_10045258	F042665	GGAG	MTSPKLSFATLIMLSAMVTVVVTLGVMPLLALTGSVAGLFFAPAAGMAAGYSTARWLGGYIDDK