NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208004_1005794

Scaffold Ga0208004_1005794


Overview

Basic Information
Taxon OID3300025630 Open in IMG/M
Scaffold IDGa0208004_1005794 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4384
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Algavirales → Phycodnaviridae → Prasinovirus → unclassified Prasinovirus → Micromonas pusilla virus 12T(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031081Metagenome / Metatranscriptome183N
F077250Metagenome / Metatranscriptome117N
F078659Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0208004_10057945F077250AGGAMNLYFIAFLFALVFIISYKPGSGTLQKWFGIKEQMHHEMMEAPEVMAPSYKVTSRDEINARELNNIFGIQR
Ga0208004_10057946F031081GGAMAKVERSSYPVKKFMIKSPKGETIYFGQAGYGDYDLWSRVDPEYAEKKRYRYTTSHKAILLKDGTPAWKSPETAEYYAMRGTWDEPRGNPLFKQVVAMRNKSLTKEEKAFIAKHKKLH
Ga0208004_10057948F078659N/AMWYEPEVEYDTRLVDLTQIMMTPAIFRAVKRAGGKVKEKDYEKDPNPAPTPLKEDIAKLDFFEGSPVKVKEHGDFYSIIDGRHRVAAMLLKNFRQISVEVVSDN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.