NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208004_1000666

Scaffold Ga0208004_1000666


Overview

Basic Information
Taxon OID3300025630 Open in IMG/M
Scaffold IDGa0208004_1000666 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13333
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (31.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000919Metagenome / Metatranscriptome834Y
F005089Metagenome / Metatranscriptome412Y
F033413Metagenome / Metatranscriptome177Y
F077968Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0208004_100066616F000919GGAGMRFRNIEFRWSKCNNKYELVKWYPQTHGETCCVVAFFDKNKEGYDMRTIGNRFFEDKDAWVVGKYGLEFLNEVFEIERIEEELK
Ga0208004_100066618F077968GGAGGMTDTWKKWNIWTSIHLFEYCVYSWRNHMWNHLDGYPNGERMRNLFWYYLNYGNTNTYYD
Ga0208004_100066627F005089N/AMNINDLYDSIKLSENLAEENYQQRNSVVDCRLDGVCNHYFPLYVEGNPSYKNGEIVLTCKLSKTVKGQFRYTYQINGKRIAKKLIASEFLSLGAFA
Ga0208004_100066629F033413N/AMTVHYANLFAQNTDLTAEFVTDFSRTFKSSTFDTYTRNDGKVYIKHGLDRNYKNDVFSVEAMIYEYKGCWVGSQKNFGSFDNFADAIACARNVQLSEDSITQNEAFALMSN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.