NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208824_1021998

Scaffold Ga0208824_1021998


Overview

Basic Information
Taxon OID3300025629 Open in IMG/M
Scaffold IDGa0208824_1021998 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2809
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)34.65Long. (o)135.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014003Metagenome / Metatranscriptome266Y
F014634Metagenome / Metatranscriptome261Y
F022612Metagenome / Metatranscriptome213Y
F048731Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0208824_10219983F022612AGGAGGMRDLSIGKYTRIRKDVARRLFKEGRIIYLTPSNVAASDSNMWIKPYPIDNQAGYDFDDIVNNFEYYNCCYELGYYTNFWINEEEE
Ga0208824_10219984F048731AGGAGGVIKKALRYALTISEDPKEIKKHVEEYMAAAGFDRRYKFKWCAFSGNHRFTFSGIFEYAGQRYYFNRLNGLHLEKI
Ga0208824_10219985F014634AGGAGGMKEKIKEIFDLERIREYAEANINLTEWIEEERGEKRKILLIATLVEGGHGAYIPGMVLELFGQAEGYDLENPYNFEKNETIHDALISLEIEVNECLNQLLPSKGWYYMGYHEADGSYCLFYEEVEQV
Ga0208824_10219986F014003AGGAGGMQAVFNKVKVKSWIKKAHKSSLFAYGHGYVTDGYAMLVDEPHMHPTILKVFGTLTPECKHSAEQFERLMRLPNKPIKVIDSKLEFVLEPKRQLRILYDPKTGKEVTLNSMYFDLLNNPEACTFHTNELMSMLWIVYDNETVGVIAPYRLQDQLSHVSFKVEEETEQV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.