NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209654_1000202

Scaffold Ga0209654_1000202


Overview

Basic Information
Taxon OID3300025608 Open in IMG/M
Scaffold IDGa0209654_1000202 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)62538
Total Scaffold Genes106 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)89 (83.96%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006020Metagenome / Metatranscriptome383Y
F055434Metagenome / Metatranscriptome138Y
F103052Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209654_100020223F055434GAGGMQTCTINTHCAAVLDSNYALLTAEQLQLTQAERCFVVQFLADTLASLTQINNESIADGDDYVMRLTDSLEVMQNLQMLYETYEDDSARLTFTLADAGAALCSYDTEYRECIAEQFECECDSAAKLAKQTHNTSADFTTLALRVLCSY
Ga0209654_100020226F103052GAGGMQYTFETHGDGLWGCEEGRAVTITGFSIDYYFDSEYNEVPADHPEAQIGHVTVLHDSDWDVYTDKGFREAARFVTGIPDLDFTEQGMQEPGFASMEV
Ga0209654_10002024F006020AGGAGMRATDIIRNVLDLLDAVENTASQPKVDVEVKQNNEPENRFKSILAMLDADSFGPLANSPNEVVADIEAVTTDAGGGVNGPKHPHDIRVKDPGAYQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.