NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208248_1016212

Scaffold Ga0208248_1016212


Overview

Basic Information
Taxon OID3300025595 Open in IMG/M
Scaffold IDGa0208248_1016212 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1797
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001009Metagenome / Metatranscriptome807Y
F012962Metagenome / Metatranscriptome275Y

Sequences

Protein IDFamilyRBSSequence
Ga0208248_10162122F001009N/AMASNLNSEFNYRHQVIGSTPWEKLKTLQGFLVGRKRAAVLEKVSELKYQAKLEELKHLKEINALPHIILNLQAEIIEINSHLDDQRHAFELNRKEITILEKLINEIYIEVEPTRLRHEDGTLYTDDEMFEANANYEFTVTIGREIQSEIIANGRPSPAKLLNAMSNPQTLETLKHLGLVPKEVIMLTEKDVIPQLTNEASDKVSTTLIE
Ga0208248_10162123F012962N/ATDTIGVGTARSVIAAATYGYDKAIFGYGFSGTYLSITNLVSNTGVVATDTTGVGTARNSIAASSYN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.