NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209195_1027207

Scaffold Ga0209195_1027207


Overview

Basic Information
Taxon OID3300025590 Open in IMG/M
Scaffold IDGa0209195_1027207 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1672
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018181Metagenome / Metatranscriptome236N
F037938Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0209195_10272071F037938N/ALETLVNLLNVEVNKRTSSKTEFESKKCKKSKIDDKQRGLIRRFLNVNRWITEDFYDIRDKVLAD
Ga0209195_10272074F018181AGGAGMKAKNQSVKVNASFYKKMEYLEDIVEDAVKEELVSIAQSAVSFSPVDTGAYVTSFSFTTGAGRPRGKSSKNKPKKQNPQQKMQEGFQNLLTDINKIDLKNTASVQLRNGSPHAQDVEESGPSWRKPGYKVFAKIRDIYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.