Scaffold Ga0208938_1015837

Overview

Basic Information

• Taxon OID: 3300025587
• Scaffold ID: Ga0208938_1015837
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2465
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 37.78
  • Long. (^o): -122.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077201	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208938_10158375	F077201	AGGA	MEPSTKERIKSLEVCYQNICEDIREIKEDIGRIEHKIDKVFEVNNKQNEHIAKHSATLEHETKNIYWIMGIVAGVASGVGTALITTLMRR