NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208938_1013948

Scaffold Ga0208938_1013948


Overview

Basic Information
Taxon OID3300025587 Open in IMG/M
Scaffold IDGa0208938_1013948 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2708
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)37.78Long. (o)-122.42Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014002Metagenome / Metatranscriptome266Y
F016798Metagenome / Metatranscriptome244Y
F027161Metagenome / Metatranscriptome195Y
F030054Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0208938_10139482F014002N/AMEFNFNISELVSIIALLIAIIGGYVNTKIQLTKLVEANKNLSEKITNLDKKVSEICKKVDRIKIILAREGLNGNE
Ga0208938_10139483F027161GGAGGMNNYIRLILDNLDITYVCSVMLIGYMFTKSSLLAKIKIKKRWLIAIIGVLVAIFYYFVLKVRLDILFFSFITAEFLNLYVAEYIIDYFIKKIKKLTEKS
Ga0208938_10139485F030054N/AMSNREKWFLLIICLLLLVIMFSGECFRKKNKLIEENKILISDYKQRIDSNNLMIDSLKNELKSAKNVDTIIKIKYKQKIDSVYVYNYNDYVVFYDTLLNTNLANVDTFICFDSISVQKLTIKLINCKLDSELLANCLIQNNLYTNIINIQDSVILLQDSINTTLQENFDKKQKKLKKQRNTAIGVAFIEFLILIGVLAK
Ga0208938_10139486F016798N/AMKKFILILVLLVLVSCEKEFKQLQRSDIIYNFIALNDDLDYKLVYFCDKYDAFEHFYDIKYTIYNEIGEHNYYKDMQARMTVVSHTKDTGTCQFQNQTFYYLAEKYNIKNANILSESQQIAVMVLAFKDGKQNYWNGYKKYKKSIE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.