Scaffold Ga0208078_1025916

Overview

Basic Information

• Taxon OID: 3300025544
• Scaffold ID: Ga0208078_1025916
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1307
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow Environmental Observatory site, Barrow, Alaska
• Coordinates
  • Lat. (^o): 71.2999
  • Long. (^o): -156.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090975	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208078_10259162	F090975	AGGAG	VSFKRTSLLLLALAIAGVVAGTAISATTTPRHASILIRHETHGCHSWSANGGAFKASQSITLQRGGSLTVTNNDVMPHRLVLTRGPALRITNAMLSHMHASVKVILSKPGVYHFTTKPGEDYMSGIKTTGEDNILKLTVVVS