Scaffold Ga0207952_1000683

Overview

Basic Information

• Taxon OID: 3300025536
• Scaffold ID: Ga0207952_1000683
• Source Dataset Name: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 21879
• Total Scaffold Genes: 30
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (43.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Source Dataset Sampling Location

• Location Name: USA: California, McLaughlin Reserve
• Coordinates
  • Lat. (^o): 38.8739528
  • Long. (^o): -122.4391613

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015265	Metagenome / Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207952_100068329	F015265	N/A	MKSSTMYPAHITKNPALIEKNAIVNRNNVGLPVFLNPISDIIPIASPTKNPIRFNMFSRRNSNDGYRFINLIILIC