| Basic Information | |
|---|---|
| Taxon OID | 3300025527 Open in IMG/M |
| Scaffold ID | Ga0208714_1007131 Open in IMG/M |
| Source Dataset Name | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2988 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Barrow Environmental Observatory site, Barrow, Alaska | |||||||
| Coordinates | Lat. (o) | 71.2999 | Long. (o) | -156.61 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066272 | Metagenome / Metatranscriptome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208714_10071312 | F066272 | GAG | MLNDYITVANLLQPGPGYGTTPQDYAAWNAAMNASNISVS |
| ⦗Top⦘ |