NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207929_1000467

Scaffold Ga0207929_1000467


Overview

Basic Information
Taxon OID3300025505 Open in IMG/M
Scaffold IDGa0207929_1000467 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11176
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (35.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow Environmental Observatory site, Barrow, Alaska
CoordinatesLat. (o)71.2999Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004189Metagenome / Metatranscriptome449Y
F089566Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0207929_100046713F004189GGAGGMRRFSDRSGIDWSAFETARPGGLPDRRVKAANVTVSFKCDDGSEVAMDLPVGALEGLTDEELILLLTRGLM
Ga0207929_10004678F089566GAGMARRRFHFAIIAGVLLTVGCRGNGDSDPVPASLPGTYAYAAKGSTFKKPWEFYVKLDLTPDRHYTLTLDKNIDGQKDPRETSVGAYAVSGDQILLRDVRPPLGPSKDVHKLLIKADSLIAEVGWTSELFLKGVGAPNVVLVKRRGS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.