NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209557_1011697

Scaffold Ga0209557_1011697


Overview

Basic Information
Taxon OID3300025483 Open in IMG/M
Scaffold IDGa0209557_1011697 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3248
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046312Metagenome / Metatranscriptome151Y
F063592Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209557_10116973F046312AGGAGMNQLETYHKLRDMQRKIKHLRDLNTMGSTEDPVSRAVGLAYDNAYGMVDKIANKLYREGIAQEEPEDG
Ga0209557_10116976F063592AGGAGGMTYWVVMFDRDGGELDPEGPYDCQSDAKSHGEFMLDNRWVTYEIQTEDDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.