Scaffold Ga0208495_1040976

Overview

Basic Information

• Taxon OID: 3300025476
• Scaffold ID: Ga0208495_1040976
• Source Dataset Name: Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 837
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Crystal Bog, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0072
  • Long. (^o): -89.6063

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106197	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208495_10409761	F106197	GGTGG	MKIVLVCIPLLLLCLSVDTVSADTISAQIDSFNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPQPIYAEPGIDTYFVDPVWHIPDDAELGSYQADLYLYGYYDSNTGELSEQLDQVDQVSAFSVVG