| Basic Information | |
|---|---|
| Taxon OID | 3300025462 Open in IMG/M |
| Scaffold ID | Ga0209120_1068093 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC2_E (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 541 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Joseph's Coat, Yellowstone National Park, Washington, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085905 | Metagenome | 111 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209120_10680932 | F085905 | N/A | TDPMLYAVATGIWVINLMDDVDITETGTQKNFEYGLIYIYSNSRIDTLFVVALTHYFNVKREKEYYRSIPMDGLQNVMKSLVDFMNDKLKILDKLKEKLDERVILMMWNQLYIFVMGFLYGLYGRDTEAVFSGVVARHLLPFSVLEVIRRHTKK |
| ⦗Top⦘ |