Scaffold Ga0208039_1014367

Overview

Basic Information

• Taxon OID: 3300025454
• Scaffold ID: Ga0208039_1014367
• Source Dataset Name: Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1795
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828
  • Depth (m): 1.5 to 1.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087512	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208039_10143671	F087512	N/A	TNYHVAMMARPRKIKGEKVIQRYLATGPDDEGATVNDGPSVGPMKYTRSRDLAIFELRQSLPHHHGVAFSLDDLQIGQEIDIYAYPKESINPFRSLLQFHGTFKGETTTGLLAFDYSLSADKALLPGASGGIVVDRKTQQIVGILNERAMNGEAIALAVPVQALADFVSKVEPCLAQSIFPSTKGISPVSADLYPKFVPPPPVDRLQPRPEEPAEVKALRRKAQLLADGIRNFIAVQTFAWGSGNKEPAAMAAYEVRVLDGYQRFREYPNGKKELQDVPLPLLNTAMSTGGEWAELPQMVGTEPRFKIHQAPDAVVNQRRVKVFQYRADAEDGVCGFRSIFDFVFFKINKDVTLACYGEVWTDEETNILRISEHFEQLGWWKHYQAVVTYGWLQRSGETPRLIPLTISAQAERGKKIYWCRGRFVNYQVFSSQVKMAAK