Scaffold Ga0209741_1025000

Overview

Basic Information

• Taxon OID: 3300025440
• Scaffold ID: Ga0209741_1025000
• Source Dataset Name: Hot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - OCT_B (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1106
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat Streamer → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Octopus Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043237	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209741_10250001	F043237	AGGAGG	MDLEKTAKYIAQLSARGYKYAIIGQLSGYNRKLVKKLEYDGFVFYLCRLQTKKEVIAYCLERAQGTFKVYCLSSKPLEFPNAPLKLHYDEKSQRLRLLAQKSFISDCLNAIERASSLTYPSPKLYIAAVNKALRQLYSVLAYTYNDRERLKAIKRKVKHWVIEALKNQYGLKPKDAMTDYGRYIVKFSDVLRKKKSKKS