NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208739_1065359

Scaffold Ga0208739_1065359


Overview

Basic Information
Taxon OID3300025426 Open in IMG/M
Scaffold IDGa0208739_1065359 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)576
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032529Metagenome / Metatranscriptome179N
F061798Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
Ga0208739_10653591F032529N/AMAESRRLIDVTDTERARMKAILEEQLPGEEYAATRESCLRNLSVTKHARFHALIQERYPGNSEEQIRRRALAWEKLYEIRQVPVKESTSSKET
Ga0208739_10653592F061798N/ASQDIKQIDEILLRYVSPNNRDSARRDLVTRFELFKYQVVEDMIARLFPGEENIIRRCEAWCEAIVFQPIPLDLSQKDNGSENGNPSEGKTNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.