NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208041_1011026

Scaffold Ga0208041_1011026


Overview

Basic Information
Taxon OID3300025393 Open in IMG/M
Scaffold IDGa0208041_1011026 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2207
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameChina: Chengdu, Sichuan
CoordinatesLat. (o)30.66Long. (o)104.06Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005744Metagenome / Metatranscriptome391Y
F034940Metagenome / Metatranscriptome173Y
F043951Metagenome / Metatranscriptome155N

Sequences

Protein IDFamilyRBSSequence
Ga0208041_10110263F034940GAGGMGNDCWYYRAQYAGMTKVCMRKSIVECGRIRRFGLCPIPPDSEAWRRCGVAIGQHEIRRLVEE
Ga0208041_10110267F005744AGGAGMDDETFEIIKAGAPNAPPEQALYRIQQTYPDGSGGRLNIDWKGLHRLHELIHDRIALEECVCETCSTRGCHRPATWEIECRGVGVSGRLIYSCDEHCPDPAILSPQDEMRRLVER
Ga0208041_10110268F043951GAGGMEHLSLGRPIEASLSPRYQCPMCGQNLWTIQAPWTGWQEWYRTEDGRRHYKHSCNIMRDALVMFRRMFGQDW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.