Scaffold Ga0208041_1006798

Overview

Basic Information

• Taxon OID: 3300025393
• Scaffold ID: Ga0208041_1006798
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3448
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanofollis → Methanofollis liminatans → Methanofollis liminatans DSM 4140 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: China: Chengdu, Sichuan
• Coordinates
  • Lat. (^o): 30.66
  • Long. (^o): 104.06

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074887	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208041_10067983	F074887	GAGG	MHYEVVWPSGDLMGIFPSYPAAYQRARVWWDRGYACRIRKRVCSLAPSALTMSAAVKKLRRGEE