NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208256_1000023

Scaffold Ga0208256_1000023


Overview

Basic Information
Taxon OID3300025382 Open in IMG/M
Scaffold IDGa0208256_1000023 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)43530
Total Scaffold Genes65 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)53 (81.54%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009735Metagenome / Metatranscriptome313Y
F017289Metagenome / Metatranscriptome241Y
F050213Metagenome / Metatranscriptome145Y
F062386Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
Ga0208256_10000232F017289GGAMKTKEEIKEEIIELYGATQALSDAMNFLHAQRMEKSKQIMALNHMLKEMEDKDD
Ga0208256_100002339F062386GAGMHTKLVHEATQDSINVSIVSDGGKNTVYLVTGTIVNENDSVFDIININKLAGNPTNIRLDSTVFMVETGLRVLVNYRNQPYVLPLEGRSKIDLGWVSGLIGHEIDMVFKGTGSFFIVLDVSKMGV
Ga0208256_100002346F050213AGGAMLLQLLKSKTVLFALFLAVLSILQGYVGMLPLTPIHQMFIGIAISVVVTLLRIVTTQPISEK
Ga0208256_10000238F009735N/AMSMMTGIVEALTTKDVNTKFGTKPTYSMKVSGTWIKCGFKDPKVEVGYEVEFDGVSGTYGVETKAVNVLSKGSGTPTPATTGTSVTAPKASYGGYKDKVFPIPALHGDRAIIRQNALARATDLYIAARGGKPFELEEGNLDFVVRLARKFEAYTAGDLDLAQAMAENNEEGKQE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.