NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208504_1000020

Scaffold Ga0208504_1000020


Overview

Basic Information
Taxon OID3300025358 Open in IMG/M
Scaffold IDGa0208504_1000020 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)44939
Total Scaffold Genes60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)44 (73.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009735Metagenome / Metatranscriptome313Y
F017814Metagenome / Metatranscriptome238Y
F020318Metagenome / Metatranscriptome224Y
F062386Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
Ga0208504_100002016F009735AGGAGVLIGLIWKKSNMTMMTGIVESVSTKDVNTKFGLKPTFSMKVNGTWVKCGFKDPGVSVGNQVEFDGVTGTYGVETKKVIVLSKGTTAPAAASPASTSTPVVGKTFSGGGYKEKVFPIPPLHGDRAIVRQNALARATDIYIAARGGKPFELELSTLDLVIQFARKFEAYTAGDLDLESATNEVANEVESDISTLF
Ga0208504_100002028F017814GAGGMSQSNFDFNQFNIMTERKPAGLQIFLAQQLLSNALWSMEKYDNPHCDALADALNAVKVIRATMKAEAAQRAVGTATL
Ga0208504_100002034F020318AGGAGLEVVTKENFEEWKFHPVTSRLMRLLSEDREAMKEGLVNHSYEDEAEVKGRCRAIAIILNLEYEDLFEAKVAPNEQ
Ga0208504_100002042F062386N/AMHKQLVHEKTGDTITVSIAADGGKNIVLLVTGTIEHEDDSVFDAIDISRLSGSPSNIRLDSTVFMVESGLKVMLSYRNQPYVLPLEGRSKIDLGWVGGLIGHEIDMVFKGTGSFFIVLDISKMGV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.