Basic Information | |
---|---|
Taxon OID | 3300025326 Open in IMG/M |
Scaffold ID | Ga0209342_10056549 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3702 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, Colorado, United States | |||||||
Coordinates | Lat. (o) | 39.53 | Long. (o) | -107.78 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066901 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209342_100565491 | F066901 | AGGAG | MKSPCKAQVAWEICKLISELDVLLWDLYWDEFEAIYEREEIERYGGSTIHTDKDTAHT |
⦗Top⦘ |