NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209641_10030529

Scaffold Ga0209641_10030529


Overview

Basic Information
Taxon OID3300025322 Open in IMG/M
Scaffold IDGa0209641_10030529 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4200
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.534762Long. (o)-107.782602Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001012Metagenome / Metatranscriptome806Y

Sequences

Protein IDFamilyRBSSequence
Ga0209641_100305294F001012GGAGMPMTSMLGPVERLAKLLADATQVDEKIHDVTTALSLIKKRVSESLAQHYVAMKDYRFQMPEDLMKEEQSYERLLQALQDMKAEIAKQIRPVEEQIIQANADHLRQTFNQESRKLNKCLEEIDDNILACRQYLQDYERIRSSLHALNEKLCQLGADAIQVPDGLPSADLGDIVTSRIEHLKSQGKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.