Basic Information | |
---|---|
Taxon OID | 3300025316 Open in IMG/M |
Scaffold ID | Ga0209697_10189563 Open in IMG/M |
Source Dataset Name | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1191 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Lake Alinen Mustajarvi | |||||||
Coordinates | Lat. (o) | 61.5637 | Long. (o) | 22.044 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010068 | Metagenome / Metatranscriptome | 309 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209697_101895632 | F010068 | AGGAGG | MNVKGTFYITTKSAMALAFGDERWNSFMTRLAEKDKYFKNVIMSITLIPVDKLIVIFDEMCKEFYNSDYSQYSMFGKVGARVALSPEGPYKSYLLSKDIKQFVDFALPKLWVTYFDGGVCTTKLENNIIHFKVTGVQIKHYYFEQLLMGYFQQSIKVFGKKSVAKQVRGISSGDDDIYFQYALKDS |
⦗Top⦘ |