Scaffold Ga0209697_10166833

Overview

Basic Information

• Taxon OID: 3300025316
• Scaffold ID: Ga0209697_10166833
• Source Dataset Name: Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1313
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Finland: Lake Alinen Mustajarvi
• Coordinates
  • Lat. (^o): 61.5637
  • Long. (^o): 22.044
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044873	Metagenome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209697_101668334	F044873	N/A	MNTMIIQRDVVTLADIDEAIAHLSEMMKDRYGNRLTHQRKAFLMGELDSLLDARLEAIDGSNNNP