NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209321_10094486

Scaffold Ga0209321_10094486


Overview

Basic Information
Taxon OID3300025312 Open in IMG/M
Scaffold IDGa0209321_10094486 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1666
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012579Metagenome / Metatranscriptome279N
F025496Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0209321_100944862F025496GGAGGMPSLRDHLIRTPEVRSRNLSAWMAPALGERATPLPDRFFEEAALTVLAHVFRDSGPIREQLVYERRRFERLVQLIHRLPERGGGG
Ga0209321_100944864F012579N/AATTPATKVIYGVNELDLDLAGKSIRGIWKVLEQVLNIPRDAAVSVNGDRVQDDYVVRPGDEIEFQKQAGVKGLGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.