| Basic Information | |
|---|---|
| Taxon OID | 3300025311 Open in IMG/M |
| Scaffold ID | Ga0209343_10040519 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4492 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rifle, Colorado, United States | |||||||
| Coordinates | Lat. (o) | 39.53 | Long. (o) | -107.78 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062987 | Metagenome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209343_100405196 | F062987 | AGG | MKNPHAVVLGQLGGEARARTTTAAQRKEWARLGGEARASRHSKAQLSKWGKLGGRPPKEGKREKR |
| ⦗Top⦘ |