Scaffold Ga0208450_1008834

Overview

Basic Information

• Taxon OID: 3300025301
• Scaffold ID: Ga0208450_1008834
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3393
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 43.02
  • Long. (^o): 8.37
  • Depth (m): 2641

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020998	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208450_10088349	F020998	GGAGG	MQANARTSTRPGYVFDDHIDLMLALFDLLDQAAVDYDRSEDVVDDFQAYLKDWARRS