| Basic Information | |
|---|---|
| Taxon OID | 3300025297 Open in IMG/M |
| Scaffold ID | Ga0209758_1174328 Open in IMG/M |
| Source Dataset Name | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 523 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 35.9082 | Long. (o) | -79.0499 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089476 | Metagenome / Metatranscriptome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209758_11743281 | F089476 | N/A | GEVSMKKAFLTAVIVEIAFLGVATTASLADDLPALNSKWREPQHRTCLEITQISDALPGPAGCAQIAGRMKDDLMIGYACKSGSDISFFSGLQTDNSIKPDIFIGRYSAEAIIAQYCTRITNDWPPEYDCRNEMTFKSVSSCTP |
| ⦗Top⦘ |