Scaffold Ga0208316_1004235

Overview

Basic Information

• Taxon OID: 3300025296
• Scaffold ID: Ga0208316_1004235
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5819
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (90.91%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 38.48
  • Long. (^o): 10.16
  • Depth (m): 2304

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001594	Metagenome / Metatranscriptome	666	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208316_100423511	F001594	GGAG	MEKTKLTKNEYLDSLDPDNLNLEKSDLINFCNNCITEWSKNRRANFKFILSMELIKSGVKLTPEDVLKTVWKKILVWFWDLQYKNALA