Scaffold Ga0209002_10010631

Overview

Basic Information

• Taxon OID: 3300025289
• Scaffold ID: Ga0209002_10010631
• Source Dataset Name: Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6931
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (90.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029531	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209002_100106311	F029531	N/A	MTELPKWIAPGDAATLVWYSGRGESAEGMTLYQVAGPALDMPPASPYFLLAPVERGDFAGRLYRGEVGLQELRGFLQHCLLARGEMSESLDRIAAGVETPVLPVVDAWRGAVARPLLPYLDDIGAFLTGERPLFVTPEAYAAARQEPEQFGTAWVCDECGEAEDAGAFLWTAHAGPSVRVCFLIQNDAGVWSCRLHPFDFLKEAA