Scaffold Ga0208046_1059822

Overview

Basic Information

• Taxon OID: 3300025285
• Scaffold ID: Ga0208046_1059822
• Source Dataset Name: Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 704
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → environmental samples → uncultured Pleomorphomonas sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 50.0621
  • Long. (^o): -124.7214
  • Depth (m): 300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070028	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208046_10598221	F070028	N/A	LGLQPKPLDFDPKIFALQMYDRVAIVADLIMEHWLEGNPNPPQALINAYYDAVDGAQIAINGNRLHEQVVRPNAEFYEKLHEKFGLTENKKKNLDNTPDLF