| Basic Information | |
|---|---|
| Taxon OID | 3300025283 Open in IMG/M |
| Scaffold ID | Ga0208048_1049008 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1028 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Malawi: Central Region | |||||||
| Coordinates | Lat. (o) | -13.5167 | Long. (o) | 34.7703 | Alt. (m) | Depth (m) | 45 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002356 | Metagenome / Metatranscriptome | 567 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208048_10490081 | F002356 | N/A | MNLKSAIETLRTELRKFSTHKQAFADYTLADGTRIRVDGDLVVGTPVFVITETEVLAAPDGEHQVEGVGVVKTEAGKIVEVVAAVAAPAEEVEVAAEIAPDTAVEIVEEVKEGYPTMDPAIVEEIVKKHLVAIMDELKAAYVELGKMKDKMAAFASQMETMTDIVEKVAELPTEAPKPTASAIVEQRKASAQQNFAALAQTIQN |
| ⦗Top⦘ |