NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208048_1025530

Scaffold Ga0208048_1025530


Overview

Basic Information
Taxon OID3300025283 Open in IMG/M
Scaffold IDGa0208048_1025530 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1689
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameMalawi: Central Region
CoordinatesLat. (o)-13.5167Long. (o)34.7703Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006543Metagenome / Metatranscriptome370Y
F008236Metagenome / Metatranscriptome336Y
F053106Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0208048_10255301F008236N/AADGTTLPDMWFYTHIYDSRLVAMEKYMAVYASVHNANDKAIATEAGFKLFAWCDSDQKIAPKRPKRKAAAEVWRKSLPKLVILDGEKFITCPEIRRGRGVVTCTPTKGSVDCNLCVKGLANVLFPSH
Ga0208048_10255303F053106GGAGMAKYYVKSGTLEVILSQSNALEAAIAGLLLTNKFDTIDEHFYVDERGYRDYVSADPQTNVIATKSIVRAAGWELSREDDD
Ga0208048_10255304F006543GGAGMQKFAFVVDVVADELDRDSVVDSIRSCLSDSLPDGVHASVKAGEVKAFSEQGYKVWRARVTGVTAEAAGDAANPKKSKKELVEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.