Basic Information | |
---|---|
Taxon OID | 3300025283 Open in IMG/M |
Scaffold ID | Ga0208048_1023936 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1774 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Malawi: Central Region | |||||||
Coordinates | Lat. (o) | -13.5167 | Long. (o) | 34.7703 | Alt. (m) | Depth (m) | 45 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008236 | Metagenome / Metatranscriptome | 336 | Y |
F053106 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208048_10239362 | F053106 | AGGAG | MGKYYVKSGTLEVILSKKDSLEAAIGGLLLTNKFDTIDEYFYVDERGLRDYLTADKETNVIPTKSIVRAAGWELSRSDDE |
Ga0208048_10239365 | F008236 | N/A | ADGTTLPDMWFYTHIYDSRLVAMEKYMAVYASVHNANDKAIATEAGFKLFAWCDSDQKIAPKRPKRKAAAEAWRKSLPKLVILDGEKFITCPEIRRGRGVVTCTPTKGSVDCNLCVKGLANVLFPSH |
⦗Top⦘ |