NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208030_1011451

Scaffold Ga0208030_1011451


Overview

Basic Information
Taxon OID3300025282 Open in IMG/M
Scaffold IDGa0208030_1011451 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3250
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)38.38Long. (o)4.65Alt. (m)Depth (m)2720
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002859Metagenome / Metatranscriptome525Y
F007401Metagenome352Y

Sequences

Protein IDFamilyRBSSequence
Ga0208030_10114513F002859GAGVLIIVRPDLYEYTALPMTDELFWRRIENLRRAALTAESFEFRLLYYNQMIELMKRCP
Ga0208030_10114518F007401GGGGGVFMSDQEILKQRDLLDAILASRTTDQYERLENMKVMDSIYFKKNLPENVVLFPLQRIKRYVHTTTRKPSKKSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.