NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208449_1035410

Scaffold Ga0208449_1035410


Overview

Basic Information
Taxon OID3300025280 Open in IMG/M
Scaffold IDGa0208449_1035410 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1433
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon SCG-AAA382B04(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)7.31Alt. (m)Depth (m)2520
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000637Metagenome / Metatranscriptome969Y
F011147Metagenome294N

Sequences

Protein IDFamilyRBSSequence
Ga0208449_10354101F011147AGGAGMAEIRINATGGVKLYDADDSHYAQIVAGTITSNVNAITLG
Ga0208449_10354102F000637AGGAGGMAHADDATKAWVSAIPKKNADGNVMEWRCKYKYTLNTYSHTFDKTEKIETPSKAPDAYTQAELLTLMNKDHWDDMFNKKYAVSIASAPVITTDNSFDVSTLSES

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.