Scaffold Ga0208449_1006495

Overview

Basic Information

• Taxon OID: 3300025280
• Scaffold ID: Ga0208449_1006495
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4534
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 39.48
  • Long. (^o): 7.31
  • Depth (m): 2520

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031257	Metagenome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208449_10064952	F031257	N/A	MVKEIVLILLLFNGEMLLKPYNLIIGSSVRSHWGGTTMECLDYGDKLRLELSTHRWVEEDIMKSGWYMNDGSGTWQGFICK