Scaffold Ga0207417_1032441

Overview

Basic Information

• Taxon OID: 3300025278
• Scaffold ID: Ga0207417_1032441
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-82 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 866
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -25.4941
  • Long. (^o): -179.5286

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092707	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207417_10324412	F092707	N/A	GGSLSLGIARWKAVRGGTYQDGRPVEKPTELELAEIVDGICQRYSCLPSQIMAEDAGILRMLDIVSQGKVD