Scaffold Ga0208814_1037725

Overview

Basic Information

• Taxon OID: 3300025276
• Scaffold ID: Ga0208814_1037725
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1484
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Georgia Island
• Coordinates
  • Lat. (^o): -50.35
  • Long. (^o): -39.82
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052880	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208814_10377252	F052880	AGGAGG	MTKEYCHVAKCLDIRCPRVWGYTRQDCEQAMEQWTAKQIRFKPLALYKYPLIHMGGSEYHIDWGYENDEGKYIDNGMEVLDD