| Basic Information | |
|---|---|
| Taxon OID | 3300025276 Open in IMG/M |
| Scaffold ID | Ga0208814_1007553 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4071 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Georgia Island | |||||||
| Coordinates | Lat. (o) | -50.35 | Long. (o) | -39.82 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003286 | Metagenome / Metatranscriptome | 496 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208814_10075534 | F003286 | AGGA | MAIQLLDKKLVMKPRRSSMVRVEKELDIAENYDSDSENIYQEPRVDRFDEIIDLLKQGSVYGEKDNITLGAVDVPIEKQIAIDKASTKGLKSETYKNDSESKLDKLRKLRRGN |
| ⦗Top⦘ |