Scaffold Ga0208029_1019834

Overview

Basic Information

• Taxon OID: 3300025264
• Scaffold ID: Ga0208029_1019834
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1695
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 39.48
  • Long. (^o): 6.37
  • Depth (m): 2851

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106169	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208029_10198342	F106169	GGAGG	MKIGDLIRLSPAYPDYIGVITQVLYEDEHGFLDVEVLTHSGLESWEADEAEVISESR