| Basic Information | |
|---|---|
| Taxon OID | 3300025264 Open in IMG/M |
| Scaffold ID | Ga0208029_1014411 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2092 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 39.48 | Long. (o) | 6.37 | Alt. (m) | Depth (m) | 2851 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005319 | Metagenome | 405 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208029_10144115 | F005319 | N/A | HIPKMTQIRIEDWLKSSESDQTLEMSLDVITKKIREQMLIDFEEFMLPQARESFQKFWAGAMGAAAKELKGSEEGSQLSLMHNMTQELSGSPWYMQALASKILPMISEASNKQSKGTQKHDIGMGLQK |
| ⦗Top⦘ |