NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208182_1016261

Scaffold Ga0208182_1016261


Overview

Basic Information
Taxon OID3300025251 Open in IMG/M
Scaffold IDGa0208182_1016261 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1927
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)43.29Long. (o)8.1Alt. (m)Depth (m)2535
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000730Metagenome / Metatranscriptome917Y
F002744Metagenome / Metatranscriptome533Y
F032307Metagenome / Metatranscriptome180N

Sequences

Protein IDFamilyRBSSequence
Ga0208182_10162611F032307AGGLVVQKLLLQEGLKRTKQYSVSVLGYDFIGLAMRLGLFLTVGVLIQAYFTATISGGSFLNSIAGFFNIKFPDTLPEWLTKLFTTGYNGIAFWQILQVTAILLVIVEYM
Ga0208182_10162612F000730GAGLVSELIPPEIIPLVWFSCISVTVYVFFRVFSSTLREKFKQTNLSRRQAEKGGNTDGQIDDLITNAPRILHEIDKQIAEQTAAGVSQDQMKGLYQKKQLLSLVADNQEVINIIGKPIIKKLLGFVKAI
Ga0208182_10162614F002744N/AALVANTVAPGVGATVLYDTVSTNGAEQYYTRPTNETAAATAINTRTQGGDMTIQGGNEITGLYTVVSGATATASEHTVGYSEFISPDFNTSMPYRIAVQPTATGLGSNANAVTGGGGIMEYKMPRGKGIPLANNVTITNYYTNRDARAGGADNFINFVRYSKN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.