Scaffold Ga0208570_1040192

Overview

Basic Information

• Taxon OID: 3300025249
• Scaffold ID: Ga0208570_1040192
• Source Dataset Name: Marine microbial communities from the Deep Indian Ocean - MP1202 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 602
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Indian Ocean
• Coordinates
  • Lat. (^o): -30.33
  • Long. (^o): 103.31
  • Depth (m): 4000.85

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082562	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208570_10401921	F082562	N/A	SNILFTQVSEDSNNCFLNIELSLIHPILGGFGGTIGIEKNKFSYGLNSFGTKLNHMTKHYLLVNAEELAVYNWGVELYSDYYLKQNHAGIFLGLISSLNGFRFNDTPIPQTILVVYSVPRIGYRAYLPKKLKSFYFQFSLTTHFKVWNNKKKILYQEIDTKSIFLISQLTLGMKI