NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208570_1027427

Scaffold Ga0208570_1027427


Overview

Basic Information
Taxon OID3300025249 Open in IMG/M
Scaffold IDGa0208570_1027427 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Indian Ocean - MP1202 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)800
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth Indian Ocean
CoordinatesLat. (o)-30.33Long. (o)103.31Alt. (m)Depth (m)4000.85
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080505Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0208570_10274272F080505N/AKDDIWSQVDNKGRRWVELSWFEDPFRVDPKFSKVVKDLDTLIKGLVVKHLGPIMGQTETRAANPFELWSNMKRHLEAGRKGGGNRLRLVIKDYFDGVERILKKNSEVMGNIIYGYAKGKRMTDNSWDEQIVNNIKIKKVHIWPDSSKEMREEDEDEIKKQITDIKKWPIKAWDATIELEIYTRAVVAKEKGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.