Basic Information | |
---|---|
Taxon OID | 3300025249 Open in IMG/M |
Scaffold ID | Ga0208570_1003502 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Deep Indian Ocean - MP1202 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3344 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (88.89%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Indian Ocean | |||||||
Coordinates | Lat. (o) | -30.33 | Long. (o) | 103.31 | Alt. (m) | Depth (m) | 4000.85 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011525 | Metagenome / Metatranscriptome | 290 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208570_10035029 | F011525 | N/A | SNNRTKVTRSRFEQDVVRLDAPPWYLKPDRHETETGDAFKYFNVPYGAGVCKVSWPAGPKGQLEFEWS |
⦗Top⦘ |