Scaffold Ga0208830_1005294

Overview

Basic Information

• Taxon OID: 3300025238
• Scaffold ID: Ga0208830_1005294
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP2634 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4230
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (63.64%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Northeast of Antigua and Barbuda, North Atlantic Ocean
• Coordinates
  • Lat. (^o): 20.0
  • Long. (^o): -52.63
  • Depth (m): 4002.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016284	Metagenome / Metatranscriptome	248	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208830_100529410	F016284	AGGAG	MTSKTLKDMRKELLDKYSGKLTGYEHLADGTGEYAKTVPKDSEKESEETSEKT